1. 1 year ago  from thestuffofstars
    thestuffofstars: A series of composite images shows the path of the sun over the course of one year. The figure eight pattern that the sun makes is called an analemma. This image sequence was recorded in Turkey, starting in 2005.

    thestuffofstars:

    A series of composite images shows the path of the sun over the course of one year. The figure eight pattern that the sun makes is called an analemma.

    This image sequence was recorded in Turkey, starting in 2005.

     

  2. Notes

avatar_128
 
 
I play the saxophone. I like to climb things. I also like science and tech stuff. I'm a very do-it-yourself type person, even though I'm more clumsy than anyone you've ever met.
 
 

Following

panserbjornetheworldweliveinsurrealismamyblogschowgarfieldminusgarfieldheadphonesnotrequiredstaffpooptslaughterhouse90210givemesomethingtoreadjasonweinbergerleomeganmcisaacnanothercastleunknownskywalkercapndesdesdeviantfindsbythegodselijahteitelbaumhxcorganismfuckyeahclassicalralarenjazzchannelfuckyeahfamicombackseatgoodbyebritishpetroleumcosmicpowergluttonyisablissfuckyeahspacethestuffofstarsstatuseskevinrose
 

Tumblr